PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00350g04011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 294aa    MW: 32692.5 Da    PI: 8.8168
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00350g04011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.71.2e-3279134258
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                               +++rY+eClkNhAas+Gg+++DGCgEfmps ge+gt +alkCaAC+CHRnFHR+e+ 
  Niben101Scf00350g04011.1  79 SRARYRECLKNHAASIGGNVTDGCGEFMPS-GEKGTLEALKCAACNCHRNFHRKEQP 134
                               5789*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.3E-3081133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2282132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.9E-3182132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.78683132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.5E-29224287IPR009057Homeodomain-like
SuperFamilySSF466898.74E-17224284IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-28226283IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MALAGEDKEM RMQGSLGYHS LDQNIDQGNH HHHHQPNNNN LQPQQDNEKS SSGGTGAAPP  60
IVVPYSSGGS TNNKFKITSR ARYRECLKNH AASIGGNVTD GCGEFMPSGE KGTLEALKCA  120
ACNCHRNFHR KEQPNVDNNN AGIMVVHPLQ LPQPLPSPLP SMNHHHQHGH SVWSTMPPQP  180
VKMAFRGSGG DGSGATDSSS EELNFNTYQQ ATSVSPQPQP PFMLAKKRFR TKFTQDQKEK  240
MLEFAEKLGW RIPREDDTEV QRFCSQVGVK RQVFKVWMHN NKNPSAKKNP QEEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-242272831874ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763792.10.0PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_016490581.10.0PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9ZPW72e-60ZHD6_ARATH; Zinc-finger homeodomain protein 6
SwissprotQ9FRL56e-60ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLM0ZWJ41e-123M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095811e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.14e-58homeobox protein 33